SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6KSA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6KSA6
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily SIS domain 1.13e-67
Family mono-SIS domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6KSA6
Sequence length 323
Comment (tr|D6KSA6|D6KSA6_9FIRM) Arabinose 5-phosphate isomerase {ECO:0000313|EMBL:EFG24151.2} KW=Complete proteome OX=450749 OS=Veillonella sp. 6_1_27. GN=HMPREF0874_01828 OC=Veillonella.
Sequence
MTILEQAAQVLHEEARAIEELSSRLDHNFVNAVNMILACKGRVVCTGMGKSGHIGRKIAA
TLASTGTPALFMHPGEGVHGDLGMITEDDVVLAFSNSGETGEIISILPSLRRIGAKLICV
VGKPESTLAKNSDIVLLAEVEREACPLGLAPTTSTTVALALGDALAVCLLERHHFTPENF
AVFHPGGSLGRKLLLTVENIMHGGEDNPTVFKGATVRDALFVMTEKGLGATNVIDEEGHL
LGLVTDGDVRRGLDSGSNFLEWPVEDMMTSMPRTITKDKLAAEALHLMEKNQPRPITVLP
VVDTNNVCLGIVHITDLLRRGIV
Download sequence
Identical sequences A0A134BRZ0 D1BLH0 D1YQP7 D6KLW6 D6KSA6 T0UAF9 W1V2A4
WP_004695498.1.13496 WP_004695498.1.26527 WP_004695498.1.43318 WP_004695498.1.68909 WP_004695498.1.89407 WP_004695498.1.96711 gi|269797607|ref|YP_003311507.1| 479436.Vpar_0544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]