SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6RAK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D6RAK0
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00663
Family cAMP-binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6RAK0
Sequence length 155
Comment (tr|D6RAK0|D6RAK0_HUMAN) Rap guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSP00000421740} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RAPGEF2 OC=Catarrhini; Hominidae; Homo.
Sequence
MAFLVRCYANCLQPWSSKLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDI
YQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDD
IEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVE
Download sequence
Identical sequences A0A2J8MV42 A0A2J8W063 D6RAK0
ENSP00000421740 ENSP00000421740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]