SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6SB05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6SB05
Domain Number 1 Region: 121-270
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.57e-49
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.0000435
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 8.45e-30
Family DHN aldolase/epimerase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D6SB05
Sequence length 272
Comment (tr|D6SB05|D6SB05_FINMA) 7,8-dihydroneopterin aldolase {ECO:0000256|RuleBase:RU362079} KW=Complete proteome OX=525282 OS=Finegoldia magna ATCC 53516. GN=HMPREF0391_11627 OC=Finegoldia.
Sequence
MDYLLVKDLEIYANHGVFQSEKELGQKFLVTLKMGYNMKKGATSNNLEDSIHYGVLSKEI
YDYFRSESIDLIETVAYKLVEFILKKYKIVQELTVEIKKPWAPINLPLDTVKVTINRKKR
RYFLGIGSNIGDKQEYVNSAIDRLKNTNSIELKNVSEMYTTKAWGKTDQEDFLNCAVEIE
SYEEPEDLLKITQQIELDLGRERHEKWGPRTIDIDILFCDNEIIYTDDLKVPHPYVQDRK
FVLQPLNDFAQFFVHPVLNKTLEQLLNELENK
Download sequence
Identical sequences D6SB05
WP_002836573.1.74112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]