SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6XTM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6XTM2
Domain Number 1 Region: 183-589
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.2e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.00000542
Further Details:      
 
Domain Number 2 Region: 58-230
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.35e-36
Family Penicillin binding protein dimerisation domain 0.00015
Further Details:      
 
Domain Number 3 Region: 591-646
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.005
Further Details:      
 
Domain Number 4 Region: 649-702
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000288
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6XTM2
Sequence length 733
Comment (tr|D6XTM2|D6XTM2_BACIE) Peptidoglycan glycosyltransferase {ECO:0000313|EMBL:ADH99158.1} KW=Complete proteome OX=439292 OS=Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10). GN=Bsel_1649 OC=unclassified Sporolactobacillaceae.
Sequence
MDPQRKRSLIRRGITLMGLLLLVITVLFSRFVYIQAAKEVQGNDLASMIESRWSESRTLE
GVRGSILDRNGEVLAEEIPSYTIVAILDDSYDRHVSDPVGTASALSPVLGIEQATLEGFL
TRSAAQVELGPRAKNLSYETMREVEELDLDGILFREDPRRYYPRQQFASHVIGYTERDMS
VARMGLESTLNEFLEGEDGLLTYKRDGRRRPLLDADEQLTEPVNGSDVTLTLDAKIQTAM
EQTMDQVNEEYDPERMIAIAAHAKTGEILAMSNRPGFNPNQYEEIENYSNYAVSSRFEPG
STMKIFTLAAAIEEGVYQGDHTYQSGSYQVIDRTVRDHNQGRGWGEITYNEGLRRSSNVA
FSKLALEYLGEDTLFEYVNAFGFRDPTGIDLPNETTGLIADTYTIDAATTSFGQGSAVSP
IQQIQAATAIANNGSMMKPYVIDRIVAADGEETLYENEPTVSGNPISENTANEVLALLET
VVSGEGGTGHPYAIDGFQIAGKTGTAQIPNEGAPGYQSGHGNYIYSFLGMAPAHDPEVIV
YVAVEKPDIEPHVPGNEPVSKVFRQVMEQSLQYLNIAPTEQGEDYQVAERHPMPTFVGQD
TGRVKEQLDEEGYRVKVIGNGDIISKQTPPEGTDVVNGETVILVTDGDVTLPDLTGWSLR
TVYMLASLYDIETEPDGTGYVIRQMPAVGTPLDQLQRLAVQLSTSSLDEEEWVDEQQQDV
DSEEDSDDDFFMN
Download sequence
Identical sequences D6XTM2
gi|297583944|ref|YP_003699724.1| WP_013172582.1.4048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]