SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6XYG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6XYG8
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 3.27e-40
Family Hypothetical protein YfhH 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6XYG8
Sequence length 107
Comment (tr|D6XYG8|D6XYG8_BACIE) Uncharacterized protein {ECO:0000313|EMBL:ADI00237.1} KW=Complete proteome OX=439292 OS=Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10). GN=Bsel_2740 OC=unclassified Sporolactobacillaceae.
Sequence
MDKKYSEMSMAELQTEIGDLTVKAQKAEQRGMISEYAVHERKILMAQAYLLDPDDFRKGE
RYVFKGDEEEYFDIDYLNGVFAWGYRSGSSELEAVPISVFGKQLPVR
Download sequence
Identical sequences D6XYG8
gi|297585022|ref|YP_003700802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]