SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6Y4E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6Y4E4
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily DsrEFH-like 1.04e-19
Family DsrEF-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6Y4E4
Sequence length 120
Comment (tr|D6Y4E4|D6Y4E4_THEBD) Uncharacterized protein {ECO:0000313|EMBL:ADG87198.1} KW=Complete proteome; Reference proteome OX=469371 OS=JCM 10125 / NBRC 14880 / R51). GN=Tbis_0470 OC=Thermobispora.
Sequence
MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESAWFALPGRAKEFRLPE
ATPLEDLLDAVLTGGKVTLCTQCAARRGITVDDVIEGIRIAGAPTFVEEVLAEGAQALVY
Download sequence
Identical sequences D6Y4E4
gi|296268459|ref|YP_003651091.1| WP_013130731.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]