SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6YSS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6YSS1
Domain Number 1 Region: 5-229
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-42
Family LplA-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6YSS1
Sequence length 238
Comment (tr|D6YSS1|D6YSS1_WADCW) Putative lipoate-protein ligase A {ECO:0000313|EMBL:ADI39116.1} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_1777 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MKPAIHFLRLNHCPIFKQLQLEEALLRVDKRNWCIINEGTPDAIVMGISGKPEEFINQKR
FEKHPVPVIRRFSGGGCVYVDRDTFFVTLILNHTSSPAQPFPQQILCWTKELYQPLIGDP
TFCVRENDYVIGEHKFGGNAQYIVKNRWLHHSSLLWDFCPDKMEHLNLPSKRPDYRSNRS
HKEFLCTLKPRFSSKETFWEQLESSLSSKFHIDRVSLNEAEAALAAPHRKATEQLIDG
Download sequence
Identical sequences D6YSS1
gi|297621985|ref|YP_003710122.1| WP_013182818.1.19835 WP_013182818.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]