SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6YTZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6YTZ1
Domain Number 1 Region: 7-311
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-63
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D6YTZ1
Sequence length 314
Comment (tr|D6YTZ1|D6YTZ1_WADCW) Putative lysyl-tRNA synthetase-like protein {ECO:0000313|EMBL:ADI37602.1} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_0227 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MELEKIHILKDRSEMLAKAREFFLRRNVLEVDCPAMSKSASIDVHIDLYRCYGASQKTFY
LHSSPEYGMKKLLAEGIGDIYQLGHVFRDNEYSMRHNPEFTMAEWYRVKVPFSAIIEETV
EFIQEFIGKLPVTKISYREAFKKYAGLDYLKSSEDDLLQYLETRGIDPYQNIEEEGKDAL
LNIILGVVIEPQLGKNDICVLQYFPATQAALAKTKKRGEEEVSERFEVFHKGMELANGYH
ELTDSEEQYERLLITNSTRERLSKDTLPIDDSFIKALERGLPDCCGVSVGFDRLMMLRHQ
MDDIADVIPLPERS
Download sequence
Identical sequences D6YTZ1 F8LC37
gi|297620471|ref|YP_003708608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]