SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D6YU42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6YU42
Domain Number 1 Region: 47-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.13e-37
Family Phosphate binding protein-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6YU42
Sequence length 273
Comment (tr|D6YU42|D6YU42_WADCW) Putative bacterial extracellular solute-binding protein {ECO:0000313|EMBL:ADI37653.1} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_0278 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MSSINRKLVISITSGLFVAVALIWLILRVFSGGYTPTVPIYYIARDSTWYPADLRGKEKN
MVGFANDLIQEIADMQGFRVQVFEVGRNGLYDGLDTGRYEGVFSTLEPNPVNRKKYLFSD
PFYRLGPVLIVRENSKIASLEDLNGKILGIESGALQTFDLSEPPKVVMIPYDSSSTALER
LNANVIDAVIMDVLRAYVFTGGFYSGRLKIATSPLTDRGLRLLTRNQPNFHLLISQFNEG
LHRLQESGRYGELLDKWELIHTELVQELPDHTS
Download sequence
Identical sequences D6YU42 F8LAT9
WP_013181381.1.19835 WP_013181381.1.67671 gi|297620522|ref|YP_003708659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]