SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D6YWX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D6YWX3
Domain Number 1 Region: 3-281
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-126
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000084
Further Details:      
 
Domain Number 2 Region: 670-861
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000011
Family HD domain 0.021
Further Details:      
 
Weak hits

Sequence:  D6YWX3
Domain Number - Region: 918-1004
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0641
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D6YWX3
Sequence length 1010
Comment (tr|D6YWX3|D6YWX3_WADCW) Glycyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00255} KW=Complete proteome; Reference proteome OX=716544 OS=Waddlia chondrophila (strain ATCC VR-1470 / WSU 86-1044). GN=wcw_1282 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MITFQEIIRRLSAYWEEKGCIIHQGYDLEMGAGTMNPATFLRCLGPEPYRAAYVEPCRRP
TDGRYGENPNRVQHYFQYQVILKPSPSDMQQQYLDSLKAIGVDLSQHDIRFVHDDWENPT
IGAWGLGWEVWMDGMEITQYTYFQSVGGLSLKPVTGELTYGLERIAMYLQNVDNMFDLKW
NEHLTYGDIYHRNEVEFSRYNFEEATTEMWLTNFNFYEKEAKKLIGKKLPLPAYDFVIKA
SHAFNILDARGAISVTERTQYIGRIRDLAKMIAESYVENRKLQEFPLLEKFPSIKREMGS
LPPMNEALLKMPEGTKDHFLLEIGSEELPAAFVPIGLRNLESAIIELLNKENLSYEKLNV
YGTPRRLSVVVENLQLTISEAVEERRGPPLDRAFNEDGTLKPAGAGFLKSIGKELLDRTA
IENDEEIEIREVKGSAYLFAKVKTPGKSAARILADSLPSIILNLEFPKKMKWGDLEISYA
RPLQWIVAMIGTEVVPFIVGDLISGNASRGHRQLDPDPFEILNPQSYLETLREHRILADP
AERKQEIIKQLNTLENQLGLHVIERDAVIPQVLNLVEWPMVAKGNFDENFLKIPQEVLIS
EMVEHQKYFPVADENGKLKPQFVITCNTLPTENMIRGNQKVLSARLSDGVFLYEKDLGVP
FESFNEKLKAVTYLSGLGSIYEKVLRLEGHVEVLQEHLQISSLKNVHRAARLCKCDLVSD
MVFEFPELQGTIGRYYALAHGEKPEVAQAIEEHWMPKGENAPLPTSETGSVLCLAEKIDN
LLSCFSAGLKPTSSKDPYALRRQVLSIIRLVIAKKFRLPLKNILDKCTRNFDPMHLSSKD
QVIKEVMDFFTNRIKSIFQEYGFTKDEVEASIACGFDDIYDTFCRVQALHEFRASSEEFP
KLYEVYKRAKGQLANHSAVAFDKGLLLKDAEKELDKTLDSTKEKFEEALSHQHYAQAYQL
IAQMQPSLARLFNEVRILDEDEKIKENRIALLQRVFSLFEQLLDFSKIQD
Download sequence
Identical sequences D6YWX3 F8LDU6
gi|297621503|ref|YP_003709640.1| WP_013182345.1.19835 WP_013182345.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]