SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7A2F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7A2F4
Domain Number 1 Region: 12-295
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-95
Family Methylenetetrahydrofolate reductase 0.0000000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7A2F4
Sequence length 308
Comment (tr|D7A2F4|D7A2F4_STAND) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=639283 OS=NBRC 12443 / NCIB 9113). GN=Snov_2322 OC=Xanthobacteraceae; Starkeya.
Sequence
MSSDVERRSRRAGGRPVSVSFEFFPPKTAEMEATLWSSITRLAPLAPKFVSVTYGAGGST
RERTHATVERIVKETRLAPAAHLTCVSASKGEVDEVVRGYWDAGVRHIVALRGDPPGGVG
HLYEPHPEGYKTSADLVAGIRRTANFEVSVSAYPEKHPESPSFDTDLDILAAKVDAGATR
AITQCFFDNDLYFAYLDKVRARGIDVPVVPGILPVSNFKQAKNFSEKTGTYMPDWLAGRF
EGLDNDPETRKLIAAAVAAEQVFDLVDRGVTEFHFYTLNRADLVYAICHLLGIRPPLEAG
QSNGQAAA
Download sequence
Identical sequences D7A2F4
gi|298292297|ref|YP_003694236.1| WP_013167121.1.82231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]