SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7B0A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7B0A2
Domain Number 1 Region: 200-436
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.62e-83
Family CAT-like 0.00000806
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Single hybrid motif 3.14e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00031
Further Details:      
 
Domain Number 3 Region: 132-174
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000157
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7B0A2
Sequence length 436
Comment (tr|D7B0A2|D7B0A2_NOCDD) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex {ECO:0000256|RuleBase:RU003423} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_4806 OC=Nocardiopsis.
Sequence
MSEIQMPRLSDTMEEGVISTWVKNVGDKVASGDVLVEIETDKAVMEYEAYEDGYLVKQSV
SEGETVPIGAVIGVIADSPDAVPEDSGDGGSEPEAAPAEEEQGEKAEEIQEAAEGTEAES
AGESAASSGDGAARPRTSPLARRLAKEYGLDINRIQGSGPKGRIVRADIEAAREGGAAEQ
AAPAAQPKEEAKPAAEKAATAPAFDDGRASEELKVSNVRKVIARRLTESKQTVPHFYLRR
TIDAEALKAFRAQINEQLSSTGVKVSFNDLIVKASATALKLHPAVNTSWVDDKLLQHHRV
NVGVAVAVDAGLVVPVLHDTDKATLSEISTRTRELAGKARDGKLKPQEMSGGTFSVSNLG
MFGVDSFSAVINPPEAAILAVGAMRQEPVVVDGEVVVRNRISLELSVDHRAVDGAVGAAF
LKDLAEILEEPMRIIL
Download sequence
Identical sequences D7B0A2
WP_013155797.1.70090 WP_013155797.1.87825 gi|297563722|ref|YP_003682696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]