SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7B1W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7B1W2
Domain Number 1 Region: 17-419
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-52
Family Cytochrome P450 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7B1W2
Sequence length 421
Comment (tr|D7B1W2|D7B1W2_NOCDD) Putative cytochrome P450 {ECO:0000313|EMBL:ADH66583.1} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_1142 OC=Nocardiopsis.
Sequence
MNHSPGPEAAAPASSGPPPPSPDHAGAARLYGPDIARDPAGLYEELRGRYGPVAPVLLDG
DVPAWFVMGYRELHHVTSRPEWFARDCRRWNQWDRVGRDWPLLPYVMWTPSVMFAEGAEH
QRRAGAIGDALDAVDRADLRTLCQRAADGLVDAFRAEGEADLVSQYAHRIPAMVVARLCG
LPEAEVPALVRDVVLSLDVAADAGGAHRRLHARLDALVADRRAAPRDDVPSRLLLHPAGL
SDAEAVIDLLVVLAAAQAPTGDWIGNTLLLMLTDDQFSLTLQGGRGSAGEALNEVLWKDT
PTQNFIGRWAVQACELGGRGIRRGDMLVLGLSAANADPRLHAGLPDVHSGNRAQMSFGHG
EHGCPFPAPEIAETIARTAVESLLDRLPDVRLAVPSERLEWRPSLWMRGLFELPARFTPQ
R
Download sequence
Identical sequences D7B1W2
gi|297560115|ref|YP_003679089.1| WP_013152190.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]