SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7B626 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7B626
Domain Number 1 Region: 240-461
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.42e-63
Family CAT-like 0.0000134
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily Single hybrid motif 2.49e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00036
Further Details:      
 
Domain Number 3 Region: 169-210
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000916
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7B626
Sequence length 466
Comment (tr|D7B626|D7B626_NOCDD) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex {ECO:0000256|RuleBase:RU003423} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_0027 OC=Nocardiopsis.
Sequence
MTTQTFDLPDLGEGLTEAEVVRWLVAVGDTVAVDQPIVEVETAKSIVEVPSPFAGTVSEL
HGEEGRVMEVGRPLISVTDGSGSGAEAGAASGSGAAAKASAEGERYREEERAGTGSGNVL
IGYGTPEAAAPGRRRRPRERPPAHPAQPAAPAATPVSAARASAAPAARPPLVTSPLVRQM
AREAGLRISEVHGSGPGGLITRRDVREAIEAARAPAADSAAPAAGPEPVATGGVDARTGL
AESRRVAMSGFRRSVAASLSRSRSEIPEATVWVDVDATELVRLRRSDPSGPGLMSYVARF
VVAGLRAHPELNGRVDAERGELVQYDGINLGLAVQTDRGLVAPAVLGAHRLTTAELDGEI
RRLTAAAREGRASRAEMTGGTFTLNNYGSLRVDGSAAIINHPQVAILGLGRIMDRPWVVD
GELTVRKITQLSFAFDHRVCDGGAAAGFMRVVADAMENPAAAIARL
Download sequence
Identical sequences D7B626
gi|297559011|ref|YP_003677985.1| WP_013151086.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]