SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7B7H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7B7H1
Domain Number 1 Region: 21-166
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.36e-20
Family Hypothetical protein TT1808 (TTHA1514) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7B7H1
Sequence length 201
Comment (tr|D7B7H1|D7B7H1_NOCDD) Uncharacterized protein {ECO:0000313|EMBL:ADH67543.1} KW=Complete proteome; Reference proteome OX=446468 OS=509) (Actinomadura dassonvillei). GN=Ndas_2118 OC=Nocardiopsis.
Sequence
MPVSPVAERQSSTGSRYEPLTPPPEGFTADDLDSIPDLPPHTELIDGSLVLVTPQRNFHT
VVLSVLDTRLFEQAPDRLRVRREMTLKLGPRQRPEPDLILVQAQATGGTEQTWFAPEAVE
LVVEVVSPESELRDRERKPQLYAEAGIPNFWLIEQDRGEAVVYVHELAPTGGYTRPTVHR
QRLKTSRPFPVDIDLTEIQRR
Download sequence
Identical sequences D7B7H1
gi|297561075|ref|YP_003680049.1| WP_013153150.1.70090 WP_013153150.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]