SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7BTL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7BTL1
Domain Number 1 Region: 11-333
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.56e-102
Family DAK1 0.0000015
Further Details:      
 
Domain Number 2 Region: 372-577
Classification Level Classification E-value
Superfamily DhaL-like 8.5e-44
Family DhaL-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BTL1
Sequence length 583
Comment (tr|D7BTL1|D7BTL1_STRBB) Dihydroxyacetone kinase {ECO:0000313|EMBL:ADI07450.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_04330 OC=Streptomyces.
Sequence
MTRLFNTPAAFADEALEGFVAAHRRWVRRVPGGVVRATPTAPGQVAVVIGGGSGHYPAFS
GLVGRGLAHGAAVGNVFASPSAQQVHQVAKAAHGGGGVLLTFGNYAGDVLHFGQAEERLN
AEGIDCRTVVVTDDISSAPAEESAKRRGVAGDLAVFKTAAAAAEAGLPLDEVVRLARLAN
ARTRSFGIAFSGCTLPGADAPLFTVPESRMAVGLGIHGEPGLSEAAVPTADEAAELLVST
LLGELPEGVETPRGLRAGVILNGLGAVKYEELFVVYRTVARLLDEAGVVAVDPEVGELVT
SFDMAGVSLTLFWLTEELEPLWTAPADAPAYRKGALGPTADVSPESPENPESPEEQPEQT
TVPQASEESRAAARTVLDALAAVVRTVDEHADELGRIDAVAGDGDHGIGMRRGSEAAYEA
GRRALGLGAGAGTLLCHAADAWADRAGGTSGALWGVILRQVGTALGDADRPDAAAVATGV
AAAADGVMRLGKAEVGDKTMVDVLVPLAGALGEAVAEGQPLAAAWDAAATAAEAAAKATA
ELLPRLGRARPHAEKSLGTPDAGAVSLALIARAVHGVLAAKND
Download sequence
Identical sequences D7BTL1
WP_014176921.1.69245 WP_014176921.1.9551 gi|374987086|ref|YP_004962581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]