SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7BX33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7BX33
Domain Number - Region: 11-82
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0596
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7BX33
Sequence length 122
Comment (tr|D7BX33|D7BX33_STRBB) Putative integral membrane protein {ECO:0000313|EMBL:ADI05578.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_02457 OC=Streptomyces.
Sequence
MIDALTVALGVTALALASWCGFATYRDQPTKDWHFIGMAVVTLLGLVQLVIGIVQLARGQ
RPDESVAIFVAYLVGSGLAVPIAAFMSLAERTRWGSATVAAAAVVLAVLEVRLYDIWGGT
GA
Download sequence
Identical sequences D7BX33
gi|374985214|ref|YP_004960709.1| WP_014175055.1.69245 WP_014175055.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]