SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7C7I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7C7I1
Domain Number 1 Region: 8-139
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.98e-18
Family N-acetyl transferase, NAT 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7C7I1
Sequence length 149
Comment (tr|D7C7I1|D7C7I1_STRBB) Acetyltransferase {ECO:0000313|EMBL:ADI12529.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_09411 OC=Streptomyces.
Sequence
MGFILEGPVLEGGLVRLEPLEHRHAADLAVAADEDRSSYRFTWVPTAAEVEGYIDAQLAR
AAAGKLAPYAQVDRVSGRAVGATAYWDPRLWPQGEGLSAIEVGFTWLAPSAQGSGMNTEA
KYLLFRHAFENWGVARLMVRDPSGRSTSL
Download sequence
Identical sequences D7C7I1
WP_014181976.1.69245 WP_014181976.1.9551 gi|374992165|ref|YP_004967660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]