SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7C8X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7C8X5
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-79
Family Protein kinases, catalytic subunit 0.0000000313
Further Details:      
 
Domain Number 2 Region: 448-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 514-575
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000115
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  D7C8X5
Domain Number - Region: 585-643
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 376-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7C8X5
Sequence length 676
Comment (tr|D7C8X5|D7C8X5_STRBB) Serine/threonine protein kinase {ECO:0000313|EMBL:ADI08526.1} KW=Complete proteome; Reference proteome OX=749414 OS=Streptomyces bingchenggensis (strain BCW-1). GN=SBI_05406 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRVDLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTV
GILQALEYSHRNGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFIGDSPVAVAYQHVREEPQPPSTFD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALSAVGYGGEDQPT
TMLRSQDVGAQTSMLPPMRDDDGGFGYDERPDRRRGPEKKSNLSTILLVLAGILVLVGAI
FIGKAIFSGDKVGDKVDVPRMVGMTLAEAKETANNGHFKVAVTGSPIFCDDAKKNTVCKQ
SAVGENAIERDTGTVELTMSKGPKPAEKVEVPDVINVQYESAKEQLEAKGFKVTQKTEES
DQTPGKVTDQDPKGGEKVAPGTEITLTVARAQSKVTVPDVTTKKLADATSTLEDLGLKVQ
TTEVENADVEAGTVISQNPQPNEQVLPNTTVTLTVAKAPAQQQNVAVPQLRGQKLKDAKK
ALEAVGLTVGTVSGSQNENSTVLFSDPTEGSQVPKGQIVNLTTFDSGQGDNGGGDGGGGG
DGGTIPFGGPSGGPAT
Download sequence
Identical sequences D7C8X5
WP_014177990.1.69245 WP_014177990.1.9551 gi|374988162|ref|YP_004963657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]