SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7D9A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7D9A8
Domain Number 1 Region: 104-281
Classification Level Classification E-value
Superfamily vWA-like 2.88e-29
Family Integrin A (or I) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7D9A8
Sequence length 333
Comment (tr|D7D9A8|D7D9A8_STAHD) von Willebrand factor type A {ECO:0000313|EMBL:ADI32354.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_1256 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MVMLEYPIIIYIVPLILLSMYVLLRWGRRRVLGRIYSFNHPLTRYVSSYIRKQHDIKWYL
NIALAIASIVLIMFSLALPYTIIPRYVKTTQTLEAKISLQRKPPVVIVLDTSGSMKGDKI
ITAINAVKKFIDQTIDYVLIGLITFNDHVRIAIPPTSDQELLYKKLGEIKAFGGTIYSKP
LEIAYDWLVPFAEFNLSPTIIFVTDGLPYSQDAPLYREVVYKCARYNITIYPIFIETPGM
SIYETMMAQQRLREIANITKGQFYNVKQTNSLINLFEKLAEKTVSKAGNYILTSNINYKI
DVKNYVVEPYILAAFLVFFANMILRSLLYKSTL
Download sequence
Identical sequences D7D9A8
gi|297527229|ref|YP_003669253.1| WP_013143552.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]