SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7D9B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7D9B4
Domain Number - Region: 85-228
Classification Level Classification E-value
Superfamily vWA-like 0.000252
Family Integrin A (or I) domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7D9B4
Sequence length 295
Comment (tr|D7D9B4|D7D9B4_STAHD) Uncharacterized protein {ECO:0000313|EMBL:ADI32360.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_1262 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MPTRICRRAGLASKLSRAHFSNLMYGIVPSKIKGPGFEYVDLREYSPGDDIRFIDWRASA
RMIKPDGDYRLMVKEHLLERLVNNIVVLDYSKSMLYGDKIESAIYVLTGFLSIAHSLGDI
IDLIILHGEKPLIKHGLNPLEAINFSLNTICKVDPSGNLDLIKLSNYVKNLKNRETLLLI
TDYAHYPIEFEVLATTTHAMNTGLGIVLVSTKLELNPPSLDGYHAFYDLESADSELKTMM
SEYYRAVKTHIIKTKTALAKTRTPYIEIKELRDAMYKKLRLLKLYSITRIRYKRY
Download sequence
Identical sequences D7D9B4
gi|297527235|ref|YP_003669259.1| WP_013143558.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]