SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7D9G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7D9G5
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-43
Family GHMP Kinase, N-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 208-303,330-413
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.14e-21
Family Mevalonate kinase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7D9G5
Sequence length 424
Comment (tr|D7D9G5|D7D9G5_STAHD) GHMP kinase {ECO:0000313|EMBL:ADI32411.1} KW=Complete proteome OX=591019 OS=BK20S6-10-b1 / P8). GN=Shell_1318 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MADKDPTRYIVSEYKRFYGLEPEVIVSAPGRLDFLNTHQDYKGLPVVSIGINLRTYVAIS
RSPSNYSRIISLNMLWEDKGFQDIFRVENTFLRMDKWFGNYIRASMIALKQCCGSIGDVW
ALIYSDIPIGAGLASSAALLVAFIGGVNELYGLGLDRRDVAELAYHVEHDIMNIPCGRLD
QYGSAYGGIVRIETKPPYNVEELQRINGVFVVLDSGIKHSTADIHPLRQAEINTGLRLLL
QMNDLDRRVREKLAREYYAVKWDMIRYEEIKPYLYRLPVIPRKRIEFTFKMNDSTRLALE
VLKGGIPSFEKWVTVLGWGWRDKILEAMKNSDPVLSLIGLTMNYQHILLRDLYDVSLPQI
EKIRDAALSAGGLGAKISGAGLGGSLIVLAKDRGTAEKILRKALDNGAVRGWIVEIDSGL
RREA
Download sequence
Identical sequences D7D9G5
gi|297527286|ref|YP_003669310.1| WP_013143609.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]