SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7DZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7DZI1
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.7e-26
Family Pentapeptide repeats 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7DZI1
Sequence length 163
Comment (tr|D7DZI1|D7DZI1_NOSA0) Pentapeptide repeat protein {ECO:0000313|EMBL:ADI62933.1} KW=Complete proteome; Reference proteome OX=551115 OS=Nostoc azollae (strain 0708) (Anabaena azollae (strain 0708)). GN=Aazo_0362 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MMYSRQGLALLLTVIICWVASPVLADWTHPLSFSNAELGRQDFSGQSLQAAEFSNANLEM
ANFAGADLRGTVFSASVMTKANLHGANLTNAMVNEVKLNGADLSDAILLEALLLRSIFTD
VNIEGADFSDAILDRSQIQELCKKASGVNSQTGVETRESLGCR
Download sequence
Identical sequences D7DZI1
gi|298489879|ref|YP_003720056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]