SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7EAR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7EAR6
Domain Number 1 Region: 12-462
Classification Level Classification E-value
Superfamily L-aspartase-like 1.88e-118
Family L-aspartase/fumarase 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7EAR6
Sequence length 492
Comment (tr|D7EAR6|D7EAR6_METEZ) Arginosuccinase {ECO:0000256|HAMAP-Rule:MF_00006} KW=Complete proteome; Reference proteome OX=644295 OS=107634 / OCM 161 / Z-7303). GN=Metev_1588 OC=Methanosarcinaceae; Methanohalobium.
Sequence
MSDILRRGRLSEIPDDEVLKYISSMETDRWIFQADILVDMAHTIMLEEQEIIHEEECTRI
LEALLKIKEDGIESLSHDYEDIHISLESKLIDMVGEDIGGKMHSGRSRNDEIATCLRIYL
RDEITGIMSELVNLRTVLLKIASYNVDTVMPGFTHLQHAQPTTFAHHLVAHAESLSRDFD
RLFDAFKRINMCPLGSAAFASTGFNLNRTRTQELLGFDGLIENSMDAVSTRDFLVESASV
LSNLMINLSRMAEEIIIWSSPEFNFVELGDKYASTSSIMPQKKNPDTAELIRGKTGSSIG
SLTSLLSICKALPMSYNRDLQEANPSIVNTVNITSSSVKIMSGMFEDMNINSEVMLSRSK
EGFTTATELADTLVRVTGIPFRTAHQIIGAIAKEPGTPTIEKIDNVSLDVLGKKLSDIGL
TEGLVQEALDPVLNIKKRDVIGGPAPDEMLRCINNCKSKLENDEKKLEKVNSNIGSSIDN
LFELVDGCIKSK
Download sequence
Identical sequences D7EAR6
gi|298675479|ref|YP_003727229.1| WP_013194998.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]