SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7GSA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7GSA2
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 4.58e-27
Family Ribosomal protein L9 C-domain 0.0000971
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.23e-17
Family Ribosomal protein L9 N-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7GSA2
Sequence length 148
Comment (tr|D7GSA2|D7GSA2_9FIRM) 50S ribosomal protein L9 {ECO:0000256|HAMAP-Rule:MF_00503} KW=Complete proteome; Reference proteome OX=245014 OS=butyrate-producing bacterium SS3/4. GN=CK3_09220 OC=Bacteria; Firmicutes; Clostridia; Clostridiales.
Sequence
MEVVLLEDVKALGKKGQVVKVNDGYARNFILPKKLGVEATSKNLNDLKLQKANAEKVAAE
QLAEAKKLAEEIDKMSVTVSIKAGEGGRAFGSVSTKEIAKAAKDQLKLDIDKKKMVLPEP
IKSIGSFEVPIKLHKEVTARLSVKVVEA
Download sequence
Identical sequences A0A1C6FC40 D7GSA2 R5G8T0
gi|479193633|ref|YP_007823171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]