SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7IPI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7IPI4
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-34
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 112-324
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.78e-21
Family alpha-mannosidase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7IPI4
Sequence length 962
Comment (tr|D7IPI4|D7IPI4_9BACE) Glycosyl hydrolase family 38 N-domain protein {ECO:0000313|EMBL:EFI09322.1} KW=Complete proteome OX=469592 OS=Bacteroides sp. 3_1_19. GN=HMPREF0104_01329 OC=Bacteroides.
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDVKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSRKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEETMVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPAEQIARLKQRVKEGRIELATMYLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYNQ
GNFFGIHTDDFEQFEERVLAYLDQMEAKNYPYDILAAQHSGYFTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADRIETIRGAWPDWWTDGFGSGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIQDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDTAGNVIPAQAGESRSDGTYWNFYVKDVPALGYAQYYIKVKDAPRPEIQGAT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNSIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVTSDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences A0A078T1A3 D7IPI4
WP_008779633.1.12386 WP_008779633.1.52717 WP_008779633.1.86952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]