SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7ITZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7ITZ2
Domain Number 1 Region: 297-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.79e-36
Family ABC transporter ATPase domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 23-292
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.14e-17
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 746-820
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000235
Family Smr domain 0.01
Further Details:      
 
Weak hits

Sequence:  D7ITZ2
Domain Number - Region: 546-671
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.068
Family Apolipophorin-III 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7ITZ2
Sequence length 822
Comment (tr|D7ITZ2|D7ITZ2_9BACE) Endonuclease MutS2 {ECO:0000256|HAMAP-Rule:MF_00092, ECO:0000256|SAAS:SAAS00250893} KW=Complete proteome OX=469592 OS=Bacteroides sp. 3_1_19. GN=HMPREF0104_02941 OC=Bacteroides.
Sequence
MIYPQNFEQKTGFDKIRHLITEKCLSPLGEERVAEMGFSADFEVVSKRLEQTDEFIRILH
GDTEFPASYFFDVRYSLKRIRPEGTWLDERELFDLKRSLQTINDIVRFFKPMDDEEIKYP
ALTELAGDIFVFPQLIGKIDSILDKFGKVKDSASSTLSQIRREMTITMSGISRSLQSILR
AAQSDGVVDKDVTPTMRDGRLMIPVAPAFKRKIKGIVHDESASGKTVFIEPEVVVEANNR
IRELEGEERREIIKILTEFTNVIRPLAPDILQSYEFLADIDFIRAKALFAEQVKAIKPIV
EDKRQMDWVRAVHPLLFLSLQKQGKQVVPLDIELTEGKRILIISGPNAGGKSVCLKTVGL
LQYMLQCGLLIPLHERSRTGIFEHIFIDIGDEQSIENDLSTYSSHLTNMKYFVKNCNERT
IILIDEFGSGTEPQIGGAIAEALLDRFNRNHSFGVITTHYQNLKHFAEDTEGIVNGAMLY
DRHLMQPLFKLSIGNPGSSFAVEIARKIGLPEDVIADASANVGADYINMDKYLQDIVRDK
RYWESKRQNIRQQEKKLEDVTSRYEQDLEAVNKQRKEIIREAKAEAQRILAEANAKIENT
VREIKEAQAEKEQTKLARKALEEFKNSVMATEEEDDKIARKMAKLKERNERKKQKQKVTA
QPIFNKEVIEVGDNVRLKGQVSAGTVMELQGKQAVVAFGMIKSTVKLEQLEKVSKGQIKR
EIQKSTFVSSQTTDNMHEKKINFKQEIDVRGMRGDEALQSVTYFIDDAIQVGAGKVRILH
GTGTGILRQLIRDYLRTVPGVRRFQDEHVQFGGAGITVVEFD
Download sequence
Identical sequences A0A174H124 A6LBE0 C7X8I7 D0TBW1 D7ITZ2
435591.BDI_1243 gi|150007883|ref|YP_001302626.1| WP_008772073.1.12386 WP_008772073.1.27322 WP_008772073.1.47855 WP_008772073.1.87144 WP_008772073.1.88644 WP_008772073.1.88798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]