SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7KEX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7KEX6
Domain Number 1 Region: 122-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.71e-22
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7KEX6
Sequence length 226
Comment (tr|D7KEX6|D7KEX6_ARALL) Uncharacterized protein {ECO:0000313|EMBL:EFH70451.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_891847 OC=Arabidopsis.
Sequence
MEMDSAQNQFNKRARLFEDSQDKDAKVIYPSNPESTEPVNKGYGGSTAIQSFFKESKAEE
TPKVLKKRGRKKKNPNPEEVNSSTPGGDDSENRSKFYESASARKRTVTAEERERAVNAAK
TFEPTNPYFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAG
RAKFSQGWYEFTLENNIGEGDVCVFELLRTRDFILKVTAFRVNEYV
Download sequence
Identical sequences D7KEX6
59689.scaffold_104641.1 XP_002894192.1.15461 jgi|Araly1|891847|scaffold_104641.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]