SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7KVT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7KVT6
Domain Number 1 Region: 113-225
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000314
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7KVT6
Sequence length 235
Comment (tr|D7KVT6|D7KVT6_ARALL) Uncharacterized protein {ECO:0000313|EMBL:EFH65463.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_895766 OC=Arabidopsis.
Sequence
MPLFVLSKSSATKSQTFMSQEQQGTSPMNTDEALKGHHCFWKTPNYLESTLSRRYQSNFS
LGSQRFSGQFLMIPNPGFVDISSMTNSQDTNPASFQPTNPKIILKEEKENEEQQYWTIKK
ELTKSNVAYGTCRRLTLSKSSVEEHILKHLLPEDSKKIDKGKPGITVMVYDHDTDTEHEL
CLAFQRSYVLKNGWVKTFIKRRGLEEGDKIGLFWECSTYKLHFSVLSRVKTKAPA
Download sequence
Identical sequences D7KVT6
jgi|Araly1|895766|scaffold_202840.1 59689.scaffold_202840.1 XP_002889204.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]