SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7L985 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7L985
Domain Number 1 Region: 120-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-24
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7L985
Sequence length 275
Comment (tr|D7L985|D7L985_ARALL) DNA binding protein {ECO:0000313|EMBL:EFH59424.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_479433 OC=Arabidopsis.
Sequence
MVESELSYEQIRLKRVEENKKRMGELNLNKLAQSLRVSSSSSKPSPAKPRTMRIPVDFSE
VRRSSRAKGPPPSYKEFGLEPLERRPRRSSQRRDLLNRVYASDDARMYAFDRAEKLQSSL
DPEFPSFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRDEMMTLVDEEDEESMVKYLAEKNG
LSGGWRGFAIDHQLVDGDAVVFQLITRTMFKVYIIRVNEDANKDSDGNEEDEDNDNELNK
KQKENVSEARQLRSSGKRKRGGNNVSNLSLPLVIS
Download sequence
Identical sequences D7L985
59689.fgenesh2_kg.3__2134__AT3G19184.1 XP_002883165.1.15461 jgi|Araly1|479433|fgenesh2_kg.3__2134__AT3G19184.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]