SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8IGD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8IGD4
Domain Number 1 Region: 34-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-80
Family Phosphate binding protein-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8IGD4
Sequence length 280
Comment (tr|D8IGD4|D8IGD4_LACFC) Lipoprotein {ECO:0000256|PIRNR:PIRNR002854} KW=Complete proteome; Reference proteome OX=712938 OS=Lactobacillus fermentum (strain CECT 5716). GN=LC40_0039 OC=Lactobacillus.
Sequence
MKNKNWIIWAVVAVVIVVIGWFSFGHSSQTSSKTVTVGVVGQTSQDEAIWKEIAKVAKDK
YGVTVKLKNFSDYNQPNKALQNGDVDLNAFQHQAFLDAWNKANKGTLVSIGKTFITPIHL
YSKKVTDVKDLPDGATIAVPNDASNESRALFLLKNAGLITLKTSAGSLATVKDIQDNPKN
LKIKEVAAEQTARTLDDVDAAVVNTNYAVAAKLPDSEIIYTEPVNKDSEQWINLIAAKKS
DANKEAYKDVVKAYHTSQVKKVIQKEYGNKEIPAWDLKLK
Download sequence
Identical sequences A0A1L7GV38 D8IGD4
gi|385811818|ref|YP_005848209.1| WP_014562066.1.34248 WP_014562066.1.49422 WP_014562066.1.74232 WP_014562066.1.82607 WP_014562066.1.86783 WP_014562066.1.88712 WP_014562066.1.93965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]