SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8J276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8J276
Domain Number 1 Region: 13-199
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-56
Family Methylesterase CheB, C-terminal domain 0.0000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8J276
Sequence length 211
Comment (tr|D8J276|D8J276_HERSS) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=757424 OS=Herbaspirillum seropedicae (strain SmR1). GN=Hsero_3378 OC=Oxalobacteraceae; Herbaspirillum.
Sequence
MSELPLPELAARPIEAIVIGASAGGVEALSEILPALRRGAAVATMVVLHLPRERPSLLAQ
IFADRCRQPVVEAQDKEPAQAGVIHFAPPDYHLLVDRSEDGPILAMSNDELVNYSRPAID
VLFESAADVYGPRLLGILLTGGNHDGAAGMQAIARAGGVTVVQSPQQAQVPYMPAQALAM
GNIDYVLTLQQIADLLRTLGASGLAQEKERR
Download sequence
Identical sequences D8J276
gi|300312675|ref|YP_003776767.1| WP_013235323.1.21123 WP_013235323.1.82484 WP_013235323.1.93079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]