SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8MMV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8MMV4
Domain Number 1 Region: 9-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.76e-81
Family L-arabinose binding protein-like 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8MMV4
Sequence length 307
Comment (tr|D8MMV4|D8MMV4_ERWBE) Periplasmic binding protein/LacI transcriptional regulator {ECO:0000313|EMBL:CAX58161.1} KW=Complete proteome; Reference proteome OX=634500 OS=Erwinia billingiae (strain Eb661). GN=EbC_06300 OC=Erwiniaceae; Erwinia.
Sequence
MKLSQSLLLVCTLALSPLSQAKEQTVGVALANFDLNFVSILRTQMVKELAKEKINGQFED
AKGDVAVQVQQVENFINQGVDAIILNPVDTQAVKPMMEAASRAKIPLIFVNRKPEIPLSA
NMAYVGSDSELGGKMEMEALAKKMNYKGNVAILMGALSAEEARQRTKATEEVIAKYKDMK
VVEKQSAQWMRNEAVDVTSGWLLNGDKIDAIAANNDEMAIGAIMALQQAGKKDVLVAGID
GTPDALRFVKSGKLSLTIFQDAAGQGMGAVQTAKKMLAGEKVESTIWIPYQTITPENYTE
FMTKNSK
Download sequence
Identical sequences D8MMV4
WP_013200666.1.56564 gi|300715218|ref|YP_003740021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]