SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8P7M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8P7M3
Domain Number 1 Region: 38-68,112-164,206-236,263-393
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.02e-25
Family Lysophospholipase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8P7M3
Sequence length 1157
Comment (tr|D8P7M3|D8P7M3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CBK43369.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE3691 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MWKACTSVGTLAFTFTLLLPLTAFPSHPHSEYDQKAAPWIGISLSGGGLRAAAFSHGVML
ELRKLCVLKPQEDSTDSDNHNGYKAPPTRFSLQYLEDKDFSDDDRSSPCGQGGRASFLDN
THFLSGVSGGAITAAYYKTHPNRLAEFGQSLKDARLARQLISGKKKTPIWRPPVMLFASL
LDTIFQTFKLPILPVPEVEVAPLATMWLYDGLFEGEQLRPVYNDLFLHGHTFGDLEEQTT
RTETLAGSLFGKAGNHQSNIGQAKLLINATDIVNGRVFTFDKETFACLGDVDGFRKLDLA
TAVAASSSLPGIFSPIRLKSLLQNTEAKLIPTNCPLIVGDQVRSPILVDGGVSDNLGVTG
LLRAIFERKNRDEFREEEQALANGHGLIVSPGETARSFLANAEITDLTTAQKANPKSQKA
FLLIVNAGVSATSSLPGMGGHLDDSFDVLMRDRTDLSRIVAQQMLDNFGFGVVELNMRDL
VKNSRVVTRIVRQSLLIQRKTNSTTDSINEVAQTFDFTEMERKVLSDLNNVGLLPSKDEI
DTLILAGRAVVAEMSGTIKKQYEELADKRYAASCDRIVNPGRHYCWPTNFETPHLVANKV
GVLLEVLTKTSEDFSKKITENRSTQLTQLRSTLWDLYANERRALDLLEIPASSMEFDQFM
KCRIKQDMIIRSAFGSQSSIGSLPYCDLCIEFHLPPQSLLRSTVDSVPACDSSEGEPEKS
LSNSPTTKLAGLLTALPTPPDMKGYVSALLNPKPPSSTITTEKKAIDSWAEKFIAHLLTD
PGAHVESPLYDWLLARFSMLQGKTTEGFHYLYRGVTTFPDDYNLSFLLGHYSIHLNRDFH
GGLDQLFLAREKAEAKKKRIDWLPDTALKDKHVARKRFSRAEEYFALQYAKYIALSPSPV
EGRSEFILGQDVDAWLNQTFPNGHGSNELSTLTTFAEGSNETTIETVNVACRNIRKSVDK
LSLPIGVKKAIEALLGHFKQIAPECQADDKTQPDDYALLEEDDLRGGSSCGDNPTSNLPS
VRNTFSARLQICQDFANVRHRIRELLAHKTALFYARAQARKLYESESVLEQQTKSSPFLW
ERADVYGLIALIDATQKECPQRTPDIHAALRLFHVARASVDQDKRLAIDKRFIEGVKKRI
SRLVEVTEEFSCGRDLD
Download sequence
Identical sequences D8P7M3
gi|302038972|ref|YP_003799294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]