SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8P8Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D8P8Q0
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.0243
Family Proline dehydrohenase domain of bifunctional PutA protein 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8P8Q0
Sequence length 120
Comment (tr|D8P8Q0|D8P8Q0_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CBK43882.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE4216 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MTAEKQSSSTRGGRRPGAGRKKGVPNKLTAALRARLDETGMTPLEAMHRAMNELCAKADR
MELGKHVTIDAKVMDYLDLLERAAEIASKLAPYRHPKLQSIEHKGEGGGPIQQRVIVEFV
Download sequence
Identical sequences D8P8Q0
gi|302039485|ref|YP_003799807.1| WP_013250702.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]