SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8P928 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8P928
Domain Number 1 Region: 12-287
Classification Level Classification E-value
Superfamily CorA soluble domain-like 7.19e-77
Family CorA soluble domain-like 0.000000346
Further Details:      
 
Domain Number 2 Region: 289-352
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 2.22e-22
Family Magnesium transport protein CorA, transmembrane region 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8P928
Sequence length 354
Comment (tr|D8P928|D8P928_9BACT) Magnesium transport protein CorA {ECO:0000256|RuleBase:RU362010} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE4350 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MTMKLKHKHSRKAGLPPGTLVHIGEKKSETVTISVYEYGEGQFQERTVSKPDEIAMTGEP
TVRWVDVGGIHKMEVLESFGKMFSLHPLLLEDIANTDQRPKLDDYGSYGYVVLKMLYEGD
REGDINVEQVSLVFGENFLLSFQENGGDVFQGVKERLRNGKGRLRHAGADYLLYALMDSI
VDRYFVILETLGERIEALQDLCVRSPGPETLRDIHGLKRQLLFLRRSVWPLRDVMNNLSR
SDGQFLQGSTKVFFRDVYDHIIQIGDTIETLREMVSSMMEVYLSSVSYRLNGVMKVLTII
TTIFMPLSFIASIYGMNFEHMPELKSPWGYPAVLGVMAATGLAMLYFFKQKKWL
Download sequence
Identical sequences D8P928
WP_013250830.1.3676 gi|302039613|ref|YP_003799935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]