SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PAC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PAC1
Domain Number 1 Region: 246-531
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.47e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000976
Further Details:      
 
Domain Number 2 Region: 68-243
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-63
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000215
Further Details:      
 
Domain Number 3 Region: 534-638
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-32
Family Anticodon-binding domain of Class II aaRS 0.0000715
Further Details:      
 
Domain Number 4 Region: 6-66
Classification Level Classification E-value
Superfamily TGS-like 0.000000000265
Family TGS domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PAC1
Sequence length 651
Comment (tr|D8PAC1|D8PAC1_9BACT) Threonyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00184} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE0403 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MASQLIQITLPDGTRKQVPAGCTVREALTPEGGRLDAKVLAAKINGEPMDLSRPLEQDAT
IEALTFESPEGREVYRHSSTHIMAQAVKEVFPTAQLTIGPALDDGFYYDFAFDRPFTPED
LEKIEARAIEIMKRGLTVTRSELSKQDAIKFFQERGEGYKVELINSFDDASPISLYRQGE
FVDLCRGPHLPTTGYVGAFKLLSTGGAYWRGDERNPMLQRVYGTSFPTKKELDAHLAKLE
EIKRRDHRKLGKELDLITIQDEIGPGLVLWHPKGSLIRLLIENFWREQHIKDGYDLVYSP
HVARLDLWKTSGHVDYYRENMFASMKLEGSEYQLKPMNCPFHIMIYKSHMRSYRDLPIRY
GELGTVYRYERTGVLHGLLRVRGFTQDDAHLFCRPDQIEAEVSRVLDFTFFVLGTFGFTE
FEVYLSTRPDKSVGSEENWTIATNALEAALKSRGVAYEVDPGEGVFYGPKIDIKIKDVLG
RSWQCSTVQVDFNNPERFKLAYTGEDGKAHQPIMIHRALMGSIERFFGILIEHYAGAFPT
WLAPVQAVVLTITDNQQEFAAKIVSTLKSHGFRVEADLRNEKIGFKIREAEKNKIPYMLV
VGDKEVQSGMVAVRGRSGANHGSMPIEAFLELLRTDANHTLRQTATHSQTR
Download sequence
Identical sequences D8PAC1
gi|302035784|ref|YP_003796106.1| WP_013247006.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]