SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PB81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PB81
Domain Number 1 Region: 95-224
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-36
Family Reductases 0.017
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.56e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8PB81
Sequence length 235
Comment (tr|D8PB81|D8PB81_9BACT) Putative FMN reductase {ECO:0000313|EMBL:CBK40490.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE0722 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MNAFTAEVSRIQDLTHDVRAIELRLLEPASITFKAGQFVSFEVPKAGQSRPLTRPYSIAS
SPGQRDRILLVLNLVQGGPGSSYLFGLREGERTSFKGPAGAFYLRDDGARDLLFVATGTG
IAPLRSMILAQLVRGDSRSVTLVWGVRSQRDLYWQEELTALAADHPNFFSVTMLSRPEPG
WQGERGRVTAWVDARISSVSKLAVYLCGGSGMIKDVTAGLNAKGLCPIYREKYYD
Download sequence
Identical sequences D8PB81
gi|302036094|ref|YP_003796416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]