SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PBB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PBB0
Domain Number 1 Region: 113-424
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000159
Further Details:      
 
Domain Number 2 Region: 5-103
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.21e-20
Family Anticodon-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PBB0
Sequence length 430
Comment (tr|D8PBB0|D8PBB0_9BACT) Asparaginyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00534} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE0751 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MSVMYIDEAAAHAGQEVTIRGWLRSRRDKGKLHFLIVRDGTGDIQAVVSKATVGDAQFAR
SAELTQESSLVLTGTLRQDARAPGGYELDVLRLDVLQVAESFPIQPKEHGTGFLMEHRHL
WLRSSRQHAVLRIRHEIIRACRNFFDDRGFTLVDAPIFTPNACEGTTTLFQTQYFDETAY
LTQSGQLYSEATAAAFGKVYCFGPTFRAEKSKTRRHLMEFWMVEPEVAFAQLPDMMDLAE
QFLAHIVAAVLKSRRAELLLLERDPAKLERVTAPFPRITYEEAIDILQRKGNPAKPGDDF
GADDETILSKEFDRPVIVHRYPAALKAFYMETDPERPDLALCMDVLAPEGYGEIIGGGQR
IHSHEKLLGRIREHHLPVEAFQWYLDLRRFGSVPHAGFGMGIERAVAWICGLDHVRETIP
FPRMLYRLYP
Download sequence
Identical sequences D8PBB0
gi|302036123|ref|YP_003796445.1| WP_013247345.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]