SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PBF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PBF4
Domain Number 1 Region: 5-122,190-310
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.66e-76
Family FabD-like 0.00000328
Further Details:      
 
Domain Number 2 Region: 129-197
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 3.14e-16
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8PBF4
Sequence length 316
Comment (tr|D8PBF4|D8PBF4_9BACT) Malonyl CoA-acyl carrier protein transacylase {ECO:0000256|PIRNR:PIRNR000446} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE0796 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MASHIGFLFPGQGSQSVGMGRGFYEASPAVKAVYDEASSILGYDVAQLCFEGPAERLNLT
ENTQPALLVSSAAALKALEPAGLKPLAVAGHSLGEYSAVYAAGGVSFRDAVALVQKRGRY
MSEAVPPGTGLVAALLGLTADVVKAVCQEAASVGVVAAANFNSPGQVVIAGEKAAVERAI
EIAKTKGCKKAIPLPVSVPVHTPLMQRAADRLAAEFGGVAWRDLAVPLVNNAEATALQRS
EDIRASLVRQLPSSVRWEESVQTMARLGVTTFVEIGPGSVLTGLVKRILPAAVTANVNDP
KSLEATLTTLGVNSQA
Download sequence
Identical sequences D8PBF4
gi|302036167|ref|YP_003796489.1| WP_013247389.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]