SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8PDM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PDM2
Domain Number 1 Region: 6-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-53
Family Glutathione peroxidase-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PDM2
Sequence length 155
Comment (tr|D8PDM2|D8PDM2_9BACT) Peroxiredoxin {ECO:0000313|EMBL:CBK41331.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE1596 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MADELDVGAKAPDFSLPDQDGSTVTLKGLKGKQVVLYFYPKDDTSGCTKEACDFRDSLAP
IKKAGAVVLGVSKDGKASHQKFIAKYGLPFALLSDEEAEVCKAYGVYKEKSMYGRKYLGI
ERSTFVIDATGRIKALFRKVKVPGHVDEVLAALKA
Download sequence
Identical sequences D8PDM2
gi|302036934|ref|YP_003797256.1| WP_013248155.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]