SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PEE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PEE3
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.82e-69
Family Glutathione peroxidase-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PEE3
Sequence length 211
Comment (tr|D8PEE3|D8PEE3_9BACT) Probable Peroxiredoxin {ECO:0000313|EMBL:CBK41602.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE1875 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MGLRLGDDAPNFTAETTEGTINFHEWLGGGWGILFSHPKDYTPVCTTELGYMARIKGEFD
KRGVKILAISVDPLDSHRGWTKDINETQNCTVSYPIIADPEKKVADLYDMIHPNSLDSMT
VRSVFVIGPDKKIKLMLTYPASCGRNFDELLRVVDSLQLTAKYKVATPVNWKDGQDCIIT
PAVNDAEAKTLFPKGFKAIKPYLRLTPQPNK
Download sequence
Identical sequences D8PEE3
WP_013248426.1.3676 gi|302037205|ref|YP_003797527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]