SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PG73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PG73
Domain Number 1 Region: 8-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-52
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 171-293
Classification Level Classification E-value
Superfamily Translation proteins 2.87e-29
Family Elongation factors 0.0092
Further Details:      
 
Domain Number 3 Region: 405-499
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.8e-22
Family EF-G/eEF-2 domains III and V 0.011
Further Details:      
 
Domain Number 4 Region: 297-375
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.34e-17
Family EF-G/eEF-2 domains III and V 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8PG73
Sequence length 603
Comment (tr|D8PG73|D8PG73_9BACT) Ribosomal back-translocase LepA {ECO:0000256|HAMAP-Rule:MF_00071} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE2551 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MSQDLQSLIRNFSIIAHIDHGKSTLADRLLDATGAVTAREAKEQILDAMDLERERGITIK
AHAVAIRYKAQDGKTYLLHLIDTPGHVDFTYEVSRSLAACEGSLLLVDATQGVQAQTIAN
VNLAMGNHHTIIPVINKIDLASADVEGTKQQISDVLTLDASDAMLVSAKEGRGVPEVLEA
IVNRIPPPSGDPDRPLKALIFDSWFDNYQGVIVLTRIIDGSVRPGMKIKVMSNDRLFEVT
EVGQFTPKRTKGTQLMTGEVGYLCANMKEVADVKIGDTLTEAAHPTEQPFPGYKEVKPLV
FCGLYSTDTARYEDLRDALLKLRLNDSSFIYEPETSLALGFGFRCGFLGLLHMEIIQERL
EREYGLTLITTAPTVIYRILTTKGDVLELNNPAELPEPSSIASFEEPFILATLIAPERYL
GTLLQLCQERRGIQRSIHYLDPTRVVISYELPLNEVILDFHDKLKSKTQGYASLDYELLG
YRESELVRLDILLNGEPVDALSFITHKERAYQRGRQVAEKMKELIPKQMFEIAIQAAIGN
KIIARETIGAIKKNVTAKCYGGDISRKRKLWDKQKEGKKRMKAVGRVEVPQEAFLAILKV
GEE
Download sequence
Identical sequences D8PG73
WP_013249081.1.3676 gi|302037863|ref|YP_003798185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]