SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8PGV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D8PGV5
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0273
Family Aromatic dioxygenase reductase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8PGV5
Sequence length 100
Comment (tr|D8PGV5|D8PGV5_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CBK42492.1} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE2787 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MAFNQVGDFWLAPGQSTRVHIALGGLVNEAEWGGHDFGAQWIMADGVGINPVRLMVSQHT
KEKKPIRLHPGSPSPIVYSVTVTNIGEELAHFTIQGGGNV
Download sequence
Identical sequences A0A1W1HP66 D8PGV5
WP_013249313.1.3676 WP_013249313.1.96234 gi|302038095|ref|YP_003798417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]