SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PKJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PKJ2
Domain Number 1 Region: 126-527
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.32e-105
Family GABA-aminotransferase-like 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PKJ2
Sequence length 645
Comment (tr|D8PKJ2|D8PKJ2_SCHCM) Delta-aminolevulinate synthase {ECO:0000256|RuleBase:RU910713} KW=Complete proteome; Reference proteome OX=578458 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus). GN=SCHCODRAFT_72395 OC=Schizophyllum.
Sequence
MGPALDVRGKQLAAGYASVAGQADVEKIHQDQGITIPPNATVEMCPHAKAARDAARIAED
LAAAAASKQQPAKKAGGCPFHAAQAQAQAKPAAAPKETVATADKKGKSPRAAGGFDYEKF
YEEELDKKHQDKSYRYFNNINRLAARFPTAHTAKVTDEVEVWCSNDYLGMGGNPVVLETM
HRVLDKYGHGAGGTRNIAGNGALHLSLEQELARLHRKEGALVFTSCYVANDATLSTLGSK
MPGCVIFSDRMNHASMIQGIRHSGTKKVIFEHNDLADLEKKLAEYPKETPKIIAFESVYS
MCGSIGPIKEICDLAEKYGAITFLDEVHAVGLYGPRGAGVAEHLDYDLHKAAGDSPDAIP
GTVMDRVDIITGTLGKSYGAIGGYIAGSARFVDMIRSYAPGFIFTTSLPPATVAGAQASV
VYQKEYLGDRQLKQVNVREVKRRFAELDIPVVPGPSHIVPVLVGDAALAKQASDKLLAEH
DIYVQAINYPTVARGEERLRITVTQRHTLEQMDHLIGAVDQVFNELNINRVQDWKRLGGR
ASVGVPGGQDFVEPIWTDEQVGLADGSAPLTLRNGQPNEVSHDAVVAARSRFDWLLGPIP
SHIQAKRLGQSLEGTPIAPLAPKQSSGLKLPVEEMTMGQTIAVAA
Download sequence
Identical sequences D8PKJ2
jgi|Schco1|72395|estExt_Genewise1.C_11606 XP_003036856.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]