SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8PSA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8PSA1
Domain Number 1 Region: 178-561,599-651
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-83
Family GABA-aminotransferase-like 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8PSA1
Sequence length 683
Comment (tr|D8PSA1|D8PSA1_SCHCM) Uncharacterized protein {ECO:0000313|EMBL:EFJ03905.1} KW=Complete proteome; Reference proteome OX=578458 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus). GN=SCHCODRAFT_64875 OC=Schizophyllum.
Sequence
MALPRATPTPSRFKRAHTSAQEYLRAIASRESGGARHSAPSVSSDASSVASVSTYASYAS
TSKTSVSPSCASEDHGSEWDSAADPLGFSRDKEADAHATPHSEYGICNDERWRYESSYRG
TPPSEGIADPPYYILLSTYISFIFVIALGHLADWMDRMRYGSVYGKSEETGLAPLTADFD
SFYTRRLKRRLLECFNQPSTGVAGRTIRILDRYSPDWNKSQILTGTTTRTLNISSYNYLG
FAQAQGGCAEGVEAGLHRYGISTCGTRAEGGSSELHVTAERLVANFVGTEDSLISSMGFA
TNSTVIPALVGKGCLIISDELNHSSIRFGARLSGAHVRLFKHNDIKELERVLRDAISQGQ
HKTHRPWRKILVIVEGLYSMEGTMVDLPGIMALKTRYKFYLFVDEAHSIGALGPHGRGVC
DYYEIIPGTNVDILMGTFTKSFGAAGGYIAGSHQIIEYLRVNGHGGVYAEAMTPPVLIQI
ITSMASIMGVVPDMQTPKKHSQQLVKAPAHPGLEGNVRLRRLAFNSRYLSRGLNALGFIT
CGHDDSPVVPLIIWSPGKMVQFHRLMLQWRDGWNRGIDGRMVCMAAAGESQEAGGDDAVR
NAWGARTPILTVVVSYPATPLITSRVRFCVSAAHTKQDMDIVLRACDQIGDWLDLKHGIP
PSKRWNIDDIVENAADLVQAETF
Download sequence
Identical sequences D8PSA1
jgi|Schco1|64875|estExt_Genewise1Plus.C_13631 XP_003038807.1.72525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]