SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8QSM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D8QSM7
Domain Number - Region: 319-353
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000239
Family Rho termination factor, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D8QSM7
Sequence length 359
Comment (tr|D8QSM7|D8QSM7_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ37465.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_403819 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MYLARSVASSNDAHRPQFPHSSMLGGPVSSLLGNGGGDGHCRAHLSLEILASRRKQGDGC
SAVTRPASLFVKRSPVPARRPLGYIPLSSISNNNPEGDEEEEEEEEEEEDLLEKEEIDGG
RLAKAKKPEPVQVRKKSDRVSKWASLFEAANGSSSSSTATAETNNNTDAWFDKIFPKNPA
GGASSPPSSSKLSAQQEKSIQQLQSLVKTLGVATKNPPPPARKNKPSKIRQLPVEGGGVV
DPVPFASILKKLQSVSSPKPEQRSRLGQELERSTKVVEELGSEEEGSETSESGGSTARIE
EESSEEEGVFSRKSAVEEINDLAKLTVPTLRGMAKSRGLSGYSRLKKDDLVHLLTSSDK
Download sequence
Identical sequences D8QSM7
XP_002962205.1.77236 jgi|Selmo1|403819|fgenesh2_pg.C_scaffold_1000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]