SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8SQV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8SQV9
Domain Number 1 Region: 74-169
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-25
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8SQV9
Sequence length 192
Comment (tr|D8SQV9|D8SQV9_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ13235.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_424732 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MVSYEEERRRRVEENKKRLKELGIAEISKEIAQQTTQRASKNQDDEPRLPRRSFCSQEDR
MAAIEAAEKIQQSLDRPSTVKTMLQSHVSGGFWLSLPLSFAKKHLPKKDTMITLEDSDGQ
ESESFYLAYKNGLSGGWRGFSIDHKLQDGDALVFELMEPTRLKVHIFRAADYQRIQGKSI
TDKAQLAKRSRR
Download sequence
Identical sequences D8SQV9
jgi|Selmo1|424732|fgenesh2_pg.C_scaffold_69000124 XP_002985657.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]