SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8TSC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8TSC1
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.49e-54
Family PP-loop ATPase 0.0003
Further Details:      
 
Domain Number 2 Region: 237-361
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000432
Family MesJ substrate recognition domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8TSC1
Sequence length 409
Comment (tr|D8TSC1|D8TSC1_VOLCA) Uncharacterized protein {ECO:0000313|EMBL:EFJ49668.1} KW=Complete proteome; Reference proteome OX=3068 OS=Volvox carteri f. nagariensis. GN=VOLCADRAFT_59111 OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
LWTSLHVKLQQSLTSSNLLGAAESVLVAVSGGQDSVCLLHALVDLRPIWGWRLGVVHCDH
GWRVDSAVNADFVRELAAQHLDLPCYVRAAPQGAVPSERAAREWRYRVFADVAFAHGYDV
VVTGHTATDRAETMLLNLLRGSGPDGLVALARSRPLGSYSPADPTCAPGGELDIPRARSR
SVRLVRPLLEFSRSQTQEFVEQLALPYFHDTTNDCNDLRRNRLRNEVLPALRAGFNPRLD
QALFRFLEVLDADLEYLTRVTEDLYDNVVSYEYRASSGDHSSVPAQGSSDERMLKLHELR
RLPLAMQRRVVRKAGARAGNAPSRVRYEDVARCLALLHAPNRSNSDSLCGGMVASVRDGH
LVLWTPKAAAVEPGWSSSQQQRRQRRAGAAADPELACCTAEVSTAGQGA
Download sequence
Identical sequences D8TSC1
jgi|Volca1|59111|e_gw1.13.32.1 XP_002949175.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]