SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9HNT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9HNT4
Domain Number 1 Region: 108-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-37
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9HNT4
Sequence length 686
Comment (tr|D9HNT4|D9HNT4_MAIZE) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d039267 OC=Zea.
Sequence
MAQGAGRDPEELFEELWRACAGPLVELPQTNERVFYFLQGHLEQLQEPTDPALLAEQIKM
FQVPNKILCKVVNVELKAETETDEMYAQITLQPEPDQVDLPQLPEPPLQETSRPVVHSFC
KILTPSDTSTHGGFSVLRRHANECLPALDMSMPTPTQELITKDLHGSEWRFKHIYRGQPR
RHLLTTGWSTFVTSKKLIAGDAFVYLRSETGQQRVGVRRLVQKQSTMPASVISSQSMHLG
VLASASHAIRTHSIFLVYYRPRLSQSQYIVRLNKYLESSKIGFDVGMRFKMSFEGDDVPI
KKFSGTVVDKGDLSPQWQGSEWKTLKVKWDEATNLNGPERVSSWEIEPFDASAPAITMPV
QPSMKNKRPRETAEGLDIHALEPAQEFWLSGRPEQHEKTSVSSSEPKHQVAWTSERAGYS
AMSSSICQNSAVTGSWFKGFNSSGSHPSLPEISQKLFQVTSNDARVPPWPGLSAYHADEP
SSKLSCNTALCSYQTEEVAPRFSNAVEEEKKEPGMFRLFGVNLINHARSSATADKTSVGA
GETSARAAGSFEDSAQLSRVTKDHTHMVNGSPREIQSHQSCSGRSRIKVQMHGNDVCRAV
DLGNLDGYEQLMGEVGEMFEIKDLGSKEKEEWKVTFINDENETMEVGAVPWQEFCQMVRK
IVIHSIGDRGHMEACPCLGQDGKRDY
Download sequence
Identical sequences D9HNT4
GRMZM2G475263_T01|PACid:20831393 XP_008673473.1.34533 GRMZM2G475263_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]